NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181373_1000077

Scaffold Ga0181373_1000077


Overview

Basic Information
Taxon OID3300017721 Open in IMG/M
Scaffold IDGa0181373_1000077 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29320
Total Scaffold Genes43 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (39.53%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-20.1Long. (o)-70.419Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004461Metagenome / Metatranscriptome437Y
F010877Metagenome / Metatranscriptome298Y
F013231Metagenome / Metatranscriptome273Y

Sequences

Protein IDFamilyRBSSequence
Ga0181373_10000771F010877N/AMTTKQLLKSLMGTGLPKGDLKQEMFSFYNSKIGTSEHFVRRENPNTSCGSCIQRVKTSIWKWYHHDESSPNYKGFVFTGRFVAHGMPLYNYDEK
Ga0181373_100007712F004461N/AMAVSISNLPYGDRSRDLFIDSMVKSAAVLNRFRLIDGVKAKVNVPIFDAALTFGTDICAWDPQSTASIGEKEMTVSDYKWSFLNCKTALEGSYRGLLLKKGQHNPETMDAEFKDWVFDYFAKLSAQKALTLAATELATEMTADASVIDNVIAGGITSANVLDHMEAAYALMSADMLSAVYGDADRDFKPAFFLGTAAMQAYQIAIAEKFTTTPQGIVEGNIPPYFGMEVVHFASLAAGEFVLCAPQNLVMLTDDYNDVRAIDMKYEPELSSDKIWGQFKLGFSYLKGEEIVYTHA
Ga0181373_100007733F013231N/AMILDNRNYKTCKLIKNRVDLYLFEMAKLFANLGSDSSAEEYAEAYKRENEMIDKIAELDPEKARSIRPYGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.