Basic Information | |
---|---|
Taxon OID | 3300017508 Open in IMG/M |
Scaffold ID | Ga0186480_1039030 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Baltic Sea in f/2 medium with sea water w/o silica, 3 C, 30 psu salinity and 302 ?mol photons light - Scrippsiella Hangoei SHTV-5 (MMETSP0361) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 972 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 59.51 | Long. (o) | 23.13 | Alt. (m) | Depth (m) | 40 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043414 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186480_10390301 | F043414 | N/A | VPKGLGKIRIGIIHGKVFDPVKVGTHDRNYPEKLKIKNNRGPTAAGWGGQYMADVSTGLKIARLQPDIFEIDFMKMDDVSPKRLAKNHLTFNFWGDMSIAIADGKVALGKTIMGIQKDCHNTRHYPEWNYYEWVLHKSRYMKQCIKAGIPMIPTIFVDNGFNAKAVLKQVQAKGWDKFLVKPAYLAFFGQGVIHGKTQDFVDNLEPFIQYERDNTKQKEFLVQPYMLKPNGLVFDEIRNFFVDGEWKYSIYTDGTDYEGFYEQPAGALKEACKQLAIRTYEEVKKVSKWEGKPIDTLLNRIDIGVVPDKSLKLGYKIFVNEIE |
⦗Top⦘ |