Basic Information | |
---|---|
Taxon OID | 3300017364 Open in IMG/M |
Scaffold ID | Ga0186177_1046926 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium w/o silicate, at 15 C, 31 psu salinity and 520 ?mol photons light - Pyrodinium bahamense pbaha01 (MMETSP0796) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 731 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003866 | Metagenome / Metatranscriptome | 464 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186177_10469261 | F003866 | GAG | MADADVRLTTVSKDGAKLGNLIPAGSMSKQDGKNALAGKWKIPGVGPAVELVVEGNSVKSLQAPFGNQPLMGEIEESEDMLGLHITMGGFPMKAWLKNESGSTVLAFSNGGRWSKL |
⦗Top⦘ |