Basic Information | |
---|---|
Taxon OID | 3300017350 Open in IMG/M |
Scaffold ID | Ga0186231_115703 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from South Atlantic Ocean in Standard Aquil medium with 100 uM EDTA, 4 C, 32 psu salinity and 127 ?mol photons light - Fragilariopsis kerguelensis L26-C5 (MMETSP0736) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1010 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -48.0 | Long. (o) | -16.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010973 | Metatranscriptome | 296 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186231_1157031 | F010973 | N/A | MTPFTSNYETIKETSSKDKSLDLALISGDMTTPSQGKIQSTFLQSVLSNKFTVAFVVVLLGTGLMAYNANPIASSNQPHFGDYAAIVDGSKGGGLTGSNNGGTDKDGCNCGWGPMIHGKHGKNRQ |
⦗Top⦘ |