Basic Information | |
---|---|
Taxon OID | 3300017233 Open in IMG/M |
Scaffold ID | Ga0186366_101457 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 27 C, 0 psu salinity and 313 ?mol photons light - Astrosyne radiata 13vi08-1A (MMETSP0418) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2563 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 13.4427 | Long. (o) | 144.6428 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081743 | Metagenome / Metatranscriptome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186366_1014573 | F081743 | N/A | MLERNIEDPLWLDVDCPKFGLMAEMSRVIRVSFSSEIDGLYFHKSFKGSGHPFYDSVYRKAARINKDLADHMDTCIVR |
⦗Top⦘ |