NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186561_100234

Scaffold Ga0186561_100234


Overview

Basic Information
Taxon OID3300017163 Open in IMG/M
Scaffold IDGa0186561_100234 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 10.6uM silica, 19 C, 35 psu salinity and 661 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1410)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5883
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)37.0Long. (o)-65.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001488Metagenome / Metatranscriptome686Y

Sequences

Protein IDFamilyRBSSequence
Ga0186561_1002346F001488AGGAMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNNNKFMYEKYQNLEPGEYITIKLAYGINTSQEKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.