| Basic Information | |
|---|---|
| Taxon OID | 3300017163 Open in IMG/M |
| Scaffold ID | Ga0186561_100234 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater and 400nM iron, 10.6uM silica, 19 C, 35 psu salinity and 661 ?mol photons light - Thalassiosira weissflogii CCMP 1010 (MMETSP1410) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5883 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (53.85%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 37.0 | Long. (o) | -65.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001488 | Metagenome / Metatranscriptome | 686 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186561_1002346 | F001488 | AGGA | MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNNNKFMYEKYQNLEPGEYITIKLAYGINTSQEKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |