Basic Information | |
---|---|
Taxon OID | 3300017096 Open in IMG/M |
Scaffold ID | Ga0186267_106657 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in L1 medium, 20 C, 21 psu salinity and 454 ?mol photons light - Staurosira sp. CCMP2646 (MMETSP1361) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1556 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | -36.5062 | Long. (o) | -73.1225 | Alt. (m) | Depth (m) | 92.6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051162 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186267_1066572 | F051162 | GAG | MPLVKIFARATMNKPIRLAVLQSKLCDVWRTKPNTTKLMLFRVEDWTDESFQEDCYVDIRAKGTEERTRDYVLDGMTQVQEAFRDENLIANVRLETYEGERYFHVPPPVEK |
⦗Top⦘ |