Basic Information | |
---|---|
Taxon OID | 3300017079 Open in IMG/M |
Scaffold ID | Ga0186531_102829 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 150 ?mol photons light - Cyclotella meneghiniana CCMP 338 (MMETSP1057) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3190 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 43.8442 | Long. (o) | -69.641 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041807 | Metagenome / Metatranscriptome | 159 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186531_1028291 | F041807 | AGGGGG | MACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLL |
⦗Top⦘ |