Basic Information | |
---|---|
Taxon OID | 3300017072 Open in IMG/M |
Scaffold ID | Ga0186672_114013 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in 0.2u filtered seawater with ES enrichments, NH4, 15 C, 33 psu salinity and 468 ?mol photons light - Pseudo-nitzschia australis 10249 10 AB (MMETSP0140_2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 638 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 36.60369 | Long. (o) | -121.88927 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081743 | Metagenome / Metatranscriptome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186672_1140131 | F081743 | GGA | MADPLWLDIDDPKFGPMAEFGRVVRVGFVEDLPLLSFNKRFKGSKHPFYEAVYKKAAKIDKELADNMDTCIAN |
⦗Top⦘ |