| Basic Information | |
|---|---|
| Taxon OID | 3300016916 Open in IMG/M |
| Scaffold ID | Ga0186073_100018 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium w/o silicate, at 20 C, 30 psu salinity and 483 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0752) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8897 |
| Total Scaffold Genes | 18 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017555 | Metagenome / Metatranscriptome | 240 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186073_1000186 | F017555 | AGGAG | LFLHELLKRILKQIEKQNDKENCSMVQKIVDPNFNIKTFNVKCDNELSSLAKTIIKSFKFKLYYYVMDDLVYLLKSNPTERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISLNEKSKFNRFITEQSTSFKVSNTITIKLAYQVKPVTKKLETTW |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |