NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186287_106384

Scaffold Ga0186287_106384


Overview

Basic Information
Taxon OID3300016798 Open in IMG/M
Scaffold IDGa0186287_106384 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Pacific Ocean in K medium, 20 C, 35 psu salinity and 168 ?mol photons light - Prasinoderma singularis RCC 927 (MMETSP1315)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)908
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Prasinodermophyta → Prasinodermophyceae → Prasinodermales → Prasinodermaceae → Prasinoderma → Prasinoderma singulare(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-34.53333333Long. (o)-72.41666667Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044853Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0186287_1063841F044853N/AMRSVTSSALALALALAVGGASAQLEGGGGGFYEECPHPHSDNDIDIVVANTYNSQGEKPKCGPTGMDGEVDPNTLDTQNIVECHQQIVAGTNYNFVLNAMDGVLFCDVQWPPAGGGLPEYDCSLHEHAKNRYPCVDPGTCSKHCLHHGCKQA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.