| Basic Information | |
|---|---|
| Taxon OID | 3300016730 Open in IMG/M |
| Scaffold ID | Ga0181515_1247333 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 15991 |
| Total Scaffold Genes | 18 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (61.11%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 47.1149 | Long. (o) | -88.5476 | Alt. (m) | Depth (m) | .3 to .4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000688 | Metagenome / Metatranscriptome | 937 | Y |
| F001371 | Metagenome / Metatranscriptome | 712 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181515_124733312 | F001371 | N/A | MFQSGNYTGTSSRYPSSNEMMTLRTEASIRKAAEPDLEVGLICADRDGNRIRIDRIDHDNHAECSAGTVSYHFLNDELRVQEGIQQRSIEQFLAEGWYLAAAGRSL |
| Ga0181515_12473337 | F000688 | N/A | MAEGGQRTRAKLQSISINGGLLQLQHELSAGDFVEIAFHTRSGPICGMAEMLQPTRKFQSACLQPFRFIALGDDDHRKLRMALDSALDRSFLDPGSERPQTRAGL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |