NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0132255_105604092

Scaffold Ga0132255_105604092


Overview

Basic Information
Taxon OID3300015374 Open in IMG/M
Scaffold IDGa0132255_105604092 Open in IMG/M
Source Dataset NameCol-0 rhizosphere combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUniversity of North Carolina
CoordinatesLat. (o)35.9Long. (o)-79.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036419Metagenome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0132255_1056040922F036419N/APRAQVHWDLRPTLWATFKRFVVYSRNNIRAGLFWQWQATVLFKYYGVLAILLAAVLIFKPSLVWFVIAAWLLLLMARAAVAIRRNRFCYPASFLQNVMRGAMVMSLIAVLDAAAIIGSIQWLLLDCFRWSRKTPVEAGNDA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.