Basic Information | |
---|---|
Taxon OID | 3300015240 Open in IMG/M |
Scaffold ID | Ga0182876_10030702 Open in IMG/M |
Source Dataset Name | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kc |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Laval University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 730 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kuujjuarapik | |||||||
Coordinates | Lat. (o) | 55.275009 | Long. (o) | -77.758484 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043249 | Metagenome / Metatranscriptome | 156 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182876_100307021 | F043249 | GAGG | MPKIVGTRERIHQPFYDSLIRIDGSGDLRQANVGVFGAVQSRSQLFTRQGSDIASSNLSTGGFFPSDQTFVILAVRVWTYFRFNTESSRSTAGADPALFPPINANAPSPVSVGPGVTADRISRVHKLYHQTQNQLFWQFQAGDKPQFTTYTAYTPFAGGLDGFFSDSRLPRANNGVPTSSALMRLARPILIPPRQGFVVIAIASPIGQAQ |
⦗Top⦘ |