Basic Information | |
---|---|
Taxon OID | 3300015215 Open in IMG/M |
Scaffold ID | Ga0182874_10019120 Open in IMG/M |
Source Dataset Name | Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island , Canada - Sample WHb |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Laval University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 674 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Subglacial Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Nunavut | |||||||
Coordinates | Lat. (o) | 83.079722 | Long. (o) | -74.138056 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050165 | Metagenome / Metatranscriptome | 145 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182874_100191201 | F050165 | GAG | MNPTFERALWASTPALRCLAPLDAILAPALGLYWIKTLPASGGLVGAVLGVFCLWIGARRAYRALFEFEAYRWMTLRLAKLAIATWVVMAMVKLVWFIQGSL* |
⦗Top⦘ |