NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167633_101109

Scaffold Ga0167633_101109


Overview

Basic Information
Taxon OID3300015069 Open in IMG/M
Scaffold IDGa0167633_101109 Open in IMG/M
Source Dataset NameArctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Bristol
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7487
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location NameRussell glacier, Kangerlussuaq, Greenland
CoordinatesLat. (o)67.156843Long. (o)-50.082361Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054743Metagenome / Metatranscriptome139Y
F061688Metagenome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0167633_1011095F061688N/AMEYRFHDTAHVEKRGRERGFTVEQAMLTISDPASILKTPPRKGNHGGFIWLFFRLFESRILVVVAEVKDNECWIITGYWEEQR*
Ga0167633_1011097F054743N/AVTKAALKNFTTEIARKRREVTCLQEDLGDMLDHLAVIEARAKSANGKRYSTVEIKRALGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.