NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180104_1003037

Scaffold Ga0180104_1003037


Overview

Basic Information
Taxon OID3300014884 Open in IMG/M
Scaffold IDGa0180104_1003037 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3527
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9229Long. (o)-106.9517Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020982Metagenome / Metatranscriptome221N
F041239Metagenome / Metatranscriptome160N
F073806Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0180104_10030372F041239GGAMPELGLGLRALWEERDYKACGASMECRGRFILGKLFDRDTRMLKVAWLAAFGTRVLGPPEIRTAEITKSQWQVLLSHMGASPDEIADVQTRMSRI*
Ga0180104_10030373F020982GGAMARRHFMGSRIYKGLTYTLELEAVEESVFKAHARLSPSGPEVSIVDEASDTALKQAEAGIKHVIEQREAGAVVRERLPERMYGDVKYTIIVRTEATRVVAELYFIRSNAQPRRPGPGIFFALFEGKTKQGAIGQAERGLKAKLDKERASHRGGTLR*
Ga0180104_10030374F073806N/AMTYTTEEFVRHSLHHILRSVKYRNSFLCLPCLVTMTLESLHPGWRPSEITRALDRIYAAPAVPMESRAAFRCAHCRNVKPCLGSPYL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.