Basic Information | |
---|---|
Taxon OID | 3300014838 Open in IMG/M |
Scaffold ID | Ga0182030_10473728 Open in IMG/M |
Source Dataset Name | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1264 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Stordalen | |||||||
Coordinates | Lat. (o) | 68.35 | Long. (o) | 19.05 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006515 | Metagenome / Metatranscriptome | 371 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182030_104737282 | F006515 | AGCAGG | MKTAGFRVELSNGQIAVPPEIAAQAAPGEQILVTLFWGMSDGDAGWRATGRRRFEAAYADDDSVYESLTHDPSTR* |
⦗Top⦘ |