Basic Information | |
---|---|
Taxon OID | 3300014818 Open in IMG/M |
Scaffold ID | Ga0134300_1021690 Open in IMG/M |
Source Dataset Name | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Battelle Memorial Institute, Gulf Coast Restoration Organization |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1457 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Trondheimsfjord | |||||||
Coordinates | Lat. (o) | 63.43 | Long. (o) | 10.43 | Alt. (m) | Depth (m) | 90 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046005 | Metagenome | 152 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134300_10216903 | F046005 | AGGAG | MAKSKKKKATTQEDENLVVIKHPETDEKYSFSPDILEGGDWSGMSQNADNLFSPEEIQNYYDIALDIKLNEGNDFPNGLGSEIKHDWIQEIWDKINPGVKILSHYLEMGPLDLSNEWVGSQYTVIVCLTPDLEPEDGGALELWTPNLTDKMKAMACNTLYTFNAEEENNPDLLYSFWPRPGRQIVFDSRIPYLIRTPENGKTSLRLVFKGTNKDYPPEPTSTDEIVFTEVE* |
⦗Top⦘ |