NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0169465_1024976

Scaffold Ga0169465_1024976


Overview

Basic Information
Taxon OID3300014779 Open in IMG/M
Scaffold IDGa0169465_1024976 Open in IMG/M
Source Dataset NameSynthetic microbial communities for library methods comparison from University of Liverpool, United Kingdom - Mg4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Liverpool
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)944
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Dna Mixture) → Unclassified → Unclassified → Synthetic → Synthetic Microbial Community For Library Methods Comparison From University Of Liverpool, United Kingdom

Source Dataset Sampling Location
Location NameUnited Kingdom: Liverpool
CoordinatesLat. (o)53.405936Long. (o)-2.9677609Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010244Metagenome / Metatranscriptome306Y

Sequences

Protein IDFamilyRBSSequence
Ga0169465_10249762F010244N/AMFTHSDKGQKRGHKLREGKEIYQHPEGYFVVLEFEGESGKFREAFWPEDIVKDKLFL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.