Basic Information | |
---|---|
Taxon OID | 3300014652 Open in IMG/M |
Scaffold ID | Ga0134319_100112 Open in IMG/M |
Source Dataset Name | Alkaline hot spring microbial communities from Galicia, Spain - Lobios hot spring |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The University of A Coru?a |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 28840 |
Total Scaffold Genes | 31 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (67.74%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Alkaline Hot Spring → Alkaline Hot Spring Microbial Communities From Galicia, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Spain: Lobios, Galicia | |||||||
Coordinates | Lat. (o) | 41.86113 | Long. (o) | -8.1062 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099502 | Metagenome / Metatranscriptome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134319_10011210 | F099502 | AGGAG | MAEKANQESAIGTIIGWGSLGIFALWFAYQVASPLLIGEQWAEKQQDAIELVKNSKPLGNDTLYDMIRAYSLKAKENDFFVGEFSWSAIQKDGPEYEVTLLWTEGEQKKVALWRVNLENKEVRPQGDAASLPQRLAAGPPKKPAGS* |
⦗Top⦘ |