Basic Information | |
---|---|
Taxon OID | 3300014587 Open in IMG/M |
Scaffold ID | Ga0135122_104726 Open in IMG/M |
Source Dataset Name | Indoor hospital air microbial communities from San Diego, USA - 248_D2_2014-9-5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | San Diego State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 570 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: San Diego, California | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063475 | Metagenome / Metatranscriptome | 129 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0135122_1047262 | F063475 | N/A | VDNGGFIAAFLHHVFNQATLYGVIVGDQNGGSHGTPRTLQLSVPNRGTVADAD* |
⦗Top⦘ |