NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182015_10000076

Scaffold Ga0182015_10000076


Overview

Basic Information
Taxon OID3300014495 Open in IMG/M
Scaffold IDGa0182015_10000076 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)126587
Total Scaffold Genes116 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)82 (70.69%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007926Metagenome / Metatranscriptome342Y
F012243Metagenome / Metatranscriptome282Y
F078993Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0182015_1000007668F012243N/AMNLLEWYIPLGLLVLLLWILLRRRAYKVSPWFFAYVAFAVAAGAVRFAVHTHQHPYYATYWITEAVYDLLGILVMYEVLRTVLGSLTRAWWARLIFPIVLVAGAGLSLARIDAVPSRIVGLPVYIVAGEIAVRFVQVLVFAGLVALVRLLGLRWRQYAFGVATGFGIYATVMLLTTTKFSDFGTRFKFLWSVTSVVAYSVAVLIWIWFFSVPQKAETPSPDLSAPSPGDLKQYKDALRGMR*
Ga0182015_1000007686F078993AGGAVELKGDTTPEQASQPGYTTEQLTAATEENLKKIAGRQLDPSQQEMVNQIKEFMEQSKKAIADGDVQRGHNLAVKAQLLSDELVKP*
Ga0182015_1000007694F007926N/AMPLCGALRRALLALLLVSLCISLLLSPLAAKTHPAHDVDSGYIPALAVADHFLQAWQSGDTENGIALLTSRAKETATTDGIDRFFSNSAPSAYEIGRGKMLKHGRYGFPVVLVSASKNNHPRRRFSSIVIVDTGHNDWAVDKLP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.