NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181533_1248906

Scaffold Ga0181533_1248906


Overview

Basic Information
Taxon OID3300014152 Open in IMG/M
Scaffold IDGa0181533_1248906 Open in IMG/M
Source Dataset NamePeatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)663
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)47.1149Long. (o)-88.5476Alt. (m)Depth (m).6 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001490Metagenome / Metatranscriptome685Y
F002989Metagenome / Metatranscriptome515Y

Sequences

Protein IDFamilyRBSSequence
Ga0181533_12489061F002989AGGAMARFQADTPNGVAVQELEVLLRTAVFKSANQVVGCLLQRAADRIDAHYQPPPGYHYKGRATLRVEGIFGTFVLERDYYYHPGKKQGRCPTDAALGLEGSATPA
Ga0181533_12489062F001490N/AMNQLNPAQLLQQIAQIQHMEPGKLCVIGHGPTGPYYNLQCRENRKTLTLYVPADQVPVVAEHTANYRQFQDLVAQYAQLIVDRTRAERSAGAKKKTPRRSSSWPRTRKSGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.