Basic Information | |
---|---|
Taxon OID | 3300014058 Open in IMG/M |
Scaffold ID | Ga0120149_1046384 Open in IMG/M |
Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1088 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .65 | Location on Map | ||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051317 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120149_10463842 | F051317 | N/A | FGGSESKLPDSADFKEAKSAAGMPDSNGGFIYLDIKNAIPLIEGFAALSGQPLPPNVAGNLRPLRSFVAWSAGSGDSRTFDAFLEIK* |
⦗Top⦘ |