NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116693_1019796

Scaffold Ga0116693_1019796


Overview

Basic Information
Taxon OID3300013762 Open in IMG/M
Scaffold IDGa0116693_1019796 Open in IMG/M
Source Dataset NameBeach sand microbial communities from Municipal Pensacola Beach, Florida - OS-J598
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)657
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand → Beach Sand Microbial Communities From Municipal Pensacola Beach, Florida

Source Dataset Sampling Location
Location NameUSA: Municipal Pensacola Beach, FL
CoordinatesLat. (o)30.3262Long. (o)-87.1745Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046726Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0116693_10197962F046726N/ALGRISEQEKIEIIQRGFQLQAEGKISLKKYYESTDPNSLVQSKGYSIKYESIRRTKLYQQLKPSNN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.