Basic Information | |
---|---|
Taxon OID | 3300013502 Open in IMG/M |
Scaffold ID | Ga0119901_1228685 Open in IMG/M |
Source Dataset Name | Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M81612 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | California Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 560 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Australia: Brisbane, Thorneside Wastewater Treatment Plant | |||||||
Coordinates | Lat. (o) | -27.485973 | Long. (o) | 153.190699 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013721 | Metagenome / Metatranscriptome | 269 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119901_12286852 | F013721 | AGGA | MKDWDTMAVSKVGQGTLPKWWRDASGLSGGGVVEVRPLRDGLNSIVLTPKPAKRRGAVGLLAQFARCPKPIEPPERHPLPFK* |
⦗Top⦘ |