| Basic Information | |
|---|---|
| Taxon OID | 3300013006 Open in IMG/M |
| Scaffold ID | Ga0164294_10302124 Open in IMG/M |
| Source Dataset Name | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1110 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 46.008 | Long. (o) | -89.701 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003304 | Metagenome | 494 | N |
| F041081 | Metagenome | 160 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164294_103021241 | F003304 | AGGA | MKQAMVTQSFGEDWQKILDLTRPRMEAYCKRHNCDFILIDKPLTHPMQYSKSAIGNIMATKGYDQVTFVDADVLITADCPKLSEDAGVFCAFDEGAYLDRKPEMVKLAGAFGGMIEPKFYVNTGVFVIHTKAVGILSMPPIGLHPNHFAEQTWLNVMAHLWEIPLTDLDPSFNCMTSVESHFGLDRYKDAMIIHYAGQSNDLVKLAGQIKEDEAKLVGLGR* |
| Ga0164294_103021242 | F041081 | N/A | KIMIMEDVSVDFEFNGEKYTAYGNAEIDTITEDIGPVGYREHYFAEVVNNVIMSKIEISTATEDIKNPSKELLEKADDLLSIQATEDFDAGK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |