| Basic Information | |
|---|---|
| Taxon OID | 3300012951 Open in IMG/M |
| Scaffold ID | Ga0164300_10673629 Open in IMG/M |
| Source Dataset Name | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 622 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Mt. Pleasant research farm, Cornell University, New York | |||||||
| Coordinates | Lat. (o) | 42.4531 | Long. (o) | -76.3842 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040669 | Metagenome | 161 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164300_106736292 | F040669 | GAGG | MTAATDANWAPLEARLNGDVEVIREFMWMFGDKDTGVEYYKHSITRRYLLLHRDGRCFQQSLNGLVEVDFGTDLRRVREHPEEG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |