NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0164290_1020296

Scaffold Ga0164290_1020296


Overview

Basic Information
Taxon OID3300012921 Open in IMG/M
Scaffold IDGa0164290_1020296 Open in IMG/M
Source Dataset NameContaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1404
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture → Genome Sequencing Of Microcoleus Cyanobacteria Isolates From Utah, Usa

Source Dataset Sampling Location
Location NameUSA: Moab, Utah
CoordinatesLat. (o)38.5733Long. (o)-109.5498Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038305Metagenome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0164290_10202962F038305AGGMAGWGDDPTLAELRALVYEEGWTPVEVAEATSGDRVVVAGPDGERRTFSSDHIAFHRFVEGLHEDFDIPPTAASDPGGPSGDE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.