| Basic Information | |
|---|---|
| Taxon OID | 3300012886 Open in IMG/M |
| Scaffold ID | Ga0160425_1101940 Open in IMG/M |
| Source Dataset Name | Microbial communities from bioreactor (seeded with sewage sludge) at Lawrence Berkeley National Lab, California, USA - Biofuel Metagenome 8 (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 690 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Berkeley, California | |||||||
| Coordinates | Lat. (o) | 37.82 | Long. (o) | -122.29 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083634 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0160425_11019401 | F083634 | GGA | MYIMLKMADQTISLDRIKINGRVCRLARKLIVTVEHENDRLTLSNKEFGLVVSAETLEEGITGLSEELASLWEVYVDADPANLTADALRLRSNLTSLVPA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |