NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0160467_100001

Scaffold Ga0160467_100001


Overview

Basic Information
Taxon OID3300012829 Open in IMG/M
Scaffold IDGa0160467_100001 Open in IMG/M
Source Dataset NameEnriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1734829
Total Scaffold Genes1465 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1048 (71.54%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location
Location NameUSA: Madison, Wisconsin
CoordinatesLat. (o)43.073Long. (o)-89.4011Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024540Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0160467_1000011158F024540GGAGGMTSVTVRLTDREIKMLKARTGEKDASAALKAWVSRANPKRSATELRTALRDSLKEEAAGKGKTFRSGRDALRWLGS*
Ga0160467_1000011169F024540GGAGGMTSVTVRLTDREIKMLKVRTGEKDASAALKAWVSRANPKRSAAELRTALRDSLKEEAAGKGKTFRSGREAMRWLGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.