Basic Information | |
---|---|
Taxon OID | 3300012684 Open in IMG/M |
Scaffold ID | Ga0136614_11128589 Open in IMG/M |
Source Dataset Name | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 534 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Dry Valley | |||||||
Coordinates | Lat. (o) | -78.0526 | Long. (o) | 163.748 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046752 | Metagenome | 150 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136614_111285891 | F046752 | N/A | RWEGVSQVGRTQSAVVLAEIHVGAGEPGGLQLAHSAITAAVKLTSARARRLLAPLVTALEARSGPDARQLARMARQIATTRL* |
⦗Top⦘ |