| Basic Information | |
|---|---|
| Taxon OID | 3300012664 Open in IMG/M |
| Scaffold ID | Ga0157497_1000073 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 21791 |
| Total Scaffold Genes | 38 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 27 (71.05%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pefferlaw, Ontario | |||||||
| Coordinates | Lat. (o) | 44.25162 | Long. (o) | -79.2626 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016501 | Metagenome / Metatranscriptome | 246 | Y |
| F069495 | Metagenome / Metatranscriptome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157497_100007317 | F016501 | N/A | MRFFEFAGGGEGDKLVMVLRNYIGRAASKKAPSKLNWNGLNQVLQASGFEQATDYETFKAIYDSSPGVQAMVSNFNADGIELKVPGSSEDDRQSPVKSGKTSQDQVSQTADSAAAGQLAQSQATPTPPTQA* |
| Ga0157497_100007332 | F069495 | GAG | MAKITLEQLIEIAFAVEEGDPFDWGAFKQGKTEAMTMIATSILDQFDKEDMTDGDRLILLATITKLVTENMILHTKIMGLSK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |