| Basic Information | |
|---|---|
| Taxon OID | 3300012013 Open in IMG/M |
| Scaffold ID | Ga0153805_1010895 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1563 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 42.844722 | Long. (o) | -79.573889 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047653 | Metagenome | 149 | Y |
| F059956 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153805_10108952 | F059956 | GGA | MMGAGTKEAIMVSENPGVCIIPKLKKGQLVRVRQGAVGIRATTSAERNAWYVKFAEDVKAGRDFPYDSGGEPRLAPDCTEFSFSVGKCLTVTAAAASYRRIGKSWWQTPRGGLCQVLDTVTGQEWLVSKRYLEVV* |
| Ga0153805_10108953 | F047653 | GGAGG | MQSGDLVFIMGDPSRPIFGTRTVGGLNCTETITHGTPALVVDVDILDRAAKRVHVEVLVQGMTLWVPGGFVKASDATAG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |