NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0152300_143475

Scaffold Ga0152300_143475


Overview

Basic Information
Taxon OID3300011934 Open in IMG/M
Scaffold IDGa0152300_143475 Open in IMG/M
Source Dataset NameStromatolite microbial communities from hypersaline Socompa Lake, Salta, Argentina - SSH_201008
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Molecular Genetics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1158
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Stromatolites In Hypersaline Lake → Stromatolite Microbial Communities From Hypersaline Socompa Lake, Salta, Argentina

Source Dataset Sampling Location
Location NameSalta, Argentina
CoordinatesLat. (o)-24.534588Long. (o)-68.208687Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001057Metagenome / Metatranscriptome791Y

Sequences

Protein IDFamilyRBSSequence
Ga0152300_1434752F001057N/AMTNACHDNGMKSTLELDTSNRIVITRELRKAAGIPRRQKLIVSATPGRIVLEVEPNTMGQVVKRGLLRVWTGDVPETSIQDAVDQARHYSR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.