| Basic Information | |
|---|---|
| Taxon OID | 3300011337 Open in IMG/M |
| Scaffold ID | Ga0153702_1533 Open in IMG/M |
| Source Dataset Name | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12802 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (78.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Paju, Gyeonggi-do, South Korea | |||||||
| Coordinates | Lat. (o) | 37.6518694 | Long. (o) | 126.72164723 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089829 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153702_15338 | F089829 | GGA | MSKQLQDLHTLTAKATIAHKKYLAGVITKEEFMQQIDDIDCHCHSDIVLDKKHSELDACYRESLEGILRIYHLENNK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |