NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126317_10828797

Scaffold Ga0126317_10828797


Overview

Basic Information
Taxon OID3300011332 Open in IMG/M
Scaffold IDGa0126317_10828797 Open in IMG/M
Source Dataset NameSoil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)607
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location
Location NameStunt Ranch Reserve, CA
CoordinatesLat. (o)34.0938Long. (o)-118.6572Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095536Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0126317_108287971F095536N/AVKKLLLLLAFFPILIQAQSVKAKLGTGGSFIILNSGTPGVDEFVKLLVKETGEVNWYLDGQDLFIRDGFFDAFGTGELFKYDFMHVDGVRGRIGFNILGGHSDGSPGGENNLPLTSSVTLLGSIATKVRLLDAATNYLIQQDDHILII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.