| Basic Information | |
|---|---|
| Taxon OID | 3300010995 Open in IMG/M |
| Scaffold ID | Ga0139323_142522 Open in IMG/M |
| Source Dataset Name | ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 731 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_46_15 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Louisiana, Port Sulphur, Bay Sansbois east | |||||||
| Coordinates | Lat. (o) | 29.45083 | Long. (o) | -89.75005 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050899 | Metagenome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0139323_1425222 | F050899 | GAG | VGIKYKVLTVLMVVALTMASVLFGCNEELPPVEADELVISSSMIPYEVFNETANAGPQIKSWPFMLGKWTVEDMDPYAMPQGASEEKFIEGFGGAIPELYYIKRDGKKAGYGPFKLVLDISILKYEDTESAERSFINISEAQELQDSTYGGIILKNGSYTLPSWWEEMKVEWSESTMPCYLIQSNCFIIYLYGRDDVA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |