Basic Information | |
---|---|
Taxon OID | 3300010970 Open in IMG/M |
Scaffold ID | Ga0137575_10077122 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | FASTERIS |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 530 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Jussy, Geneva, SWITZERLAND | |||||||
Coordinates | Lat. (o) | 46.25 | Long. (o) | 6.28 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038107 | Metagenome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137575_100771221 | F038107 | N/A | LIETAGLNSYNFLDVGQELNSWNHLQQIQRAAFPINRTNEFNKDTTNQFFPHLMPLYYQGAASNSRLLNNPADHNQNLDMSSQRTYIKPFYTAKEQFGSVLPIEMNNSILPLGPIYVRKTVLPSNDLE* |
⦗Top⦘ |