NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137575_10023033

Scaffold Ga0137575_10023033


Overview

Basic Information
Taxon OID3300010970 Open in IMG/M
Scaffold IDGa0137575_10023033 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterFASTERIS
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1018
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location NameJussy, Geneva, SWITZERLAND
CoordinatesLat. (o)46.25Long. (o)6.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009320Metagenome / Metatranscriptome319Y
F009598Metagenome / Metatranscriptome315Y

Sequences

Protein IDFamilyRBSSequence
Ga0137575_100230331F009598GAGGMLDKQNIVVESLESPPANKGLEYQIAHEAYVKMVDYLRLTQAKNTINRLSDYHYLNIPVSNSTEPVRGIDYIAPIVSPGIDYSTAVITKCLMPDGKVNFEFERFSEDDTLQSKQAADMVKYFINSKNDSYQVIRDWAQDSLLHKNGILMISPVREPITQYKEVEGTRDQLRSFEIMAADKGLVAKRQQMRRIDVNLEGVAQETTMPDE
Ga0137575_100230332F009320N/AAGRYTLTEQSVREVFEDSYGLNCIPGAILNPPNDQGKVTNHKAYGINIMRLGMERGTLLINENCKAFLDEARNYAIDDAGRFSDPDDHIDSARIGILALVQGHGESVVSRANTFAVKRFTPIEGKVQRI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.