NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138308_100560

Scaffold Ga0138308_100560


Overview

Basic Information
Taxon OID3300010965 Open in IMG/M
Scaffold IDGa0138308_100560 Open in IMG/M
Source Dataset NameMicrobial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42046
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)42 (73.68%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland.

Source Dataset Sampling Location
Location NameLake Cadagno, Switzerland
CoordinatesLat. (o)46.5499Long. (o)8.711Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F003408Metagenome / Metatranscriptome488Y
F004840Metagenome / Metatranscriptome421Y
F030095Metagenome / Metatranscriptome186N

Sequences

Protein IDFamilyRBSSequence
Ga0138308_10056025F030095AGGMAAQKNFQVDENTTFTFEVQYLDEENDPIQLNHHTAKMQVRDTQGGKKLAFTLTEQDGIVITPSLGKISVSLSPERTKKLFYPKSAYDLVIIDPSINITRLLEGYLTLNRAVTI*
Ga0138308_1005603F004840GGAMYKLTCAYDSNTPHWSAEYENEFGAWENFFRFTDWGMANEYSTVNLSTPTGKMYTKVFYRNGMVSVK*
Ga0138308_10056056F003408N/AMQKSESEKRKFLAAIQGVDLEGGEEEENKSFEDVRRKALGITADGSDVVSLQGQFASEAGFGIGAGLGYKKE*
Ga0138308_1005609F001562GGAMKSQLEKDLEIKESFIDLLNDVYPTVKIGYSTFTPAEILECCDPVAFAIGLLEHEDYLAEMENE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.