| Basic Information | |
|---|---|
| Taxon OID | 3300010963 Open in IMG/M |
| Scaffold ID | Ga0138108_100254 Open in IMG/M |
| Source Dataset Name | Subsoil microbial communities from Rio Tinto Huelva, Spain - T211 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Autonomous University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12388 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Subsoil → Subsoil Microbial Communities From Rio Tinto Huelva, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Huelva, Spain | |||||||
| Coordinates | Lat. (o) | 37.26 | Long. (o) | -6.94 | Alt. (m) | Depth (m) | 250 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021823 | Metagenome / Metatranscriptome | 217 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138108_1002545 | F021823 | GAGG | MNAFVRRFVMHYGIYRRYPLARIDALRNAWRIARA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |