Basic Information | |
---|---|
Taxon OID | 3300010938 Open in IMG/M |
Scaffold ID | Ga0137716_10270717 Open in IMG/M |
Source Dataset Name | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 935 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment → Sediment Core Sample Microbial Community From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.7101 | Long. (o) | -110.7413 | Alt. (m) | Depth (m) | .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026930 | Metagenome / Metatranscriptome | 196 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137716_102707173 | F026930 | N/A | MPLIQDPEFGNRIVTLMAAMVLVLQILMAAQRWLVTNIRIFGIQSFLLAMIAGTIAVFN |
⦗Top⦘ |