NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137520_10569

Scaffold Ga0137520_10569


Overview

Basic Information
Taxon OID3300010899 Open in IMG/M
Scaffold IDGa0137520_10569 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample LVWS6_30_TP1_12H
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)800
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameMarker 33, Axial Seamount, Northeast Pacific Ocean
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)Depth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050360Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0137520_105691F050360GGAMSNAEFGAYQDMLRQCEESMFGGDVQDDDEQWHDVKRLLPPTSHMIWAACPNVVLCAYQTFLLYLDSDVQWRDNTGRLFARKVAFWQYADVPECNISC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.