NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133547_11504299

Scaffold Ga0133547_11504299


Overview

Basic Information
Taxon OID3300010883 Open in IMG/M
Scaffold IDGa0133547_11504299 Open in IMG/M
Source Dataset Namewestern Arctic Ocean co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1263
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)79.2466Long. (o)-150.0613Alt. (m)Depth (m)190
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000679Metagenome / Metatranscriptome939Y

Sequences

Protein IDFamilyRBSSequence
Ga0133547_115042991F000679N/AMPCNEHHQWLKKRDLPAVQGAMLAHDDGLLRRKYKERDEHGRLPHHWLAAKAQTHTQTLAEVGVQSICLNPEALTTRDKEGKTPIDIASRSGACAEIIRLLSLTPEEVRSLGGKGMDRLYAPVSYWRNEMVKWIRSRSYADCHKFIDEHDDELVREVLKYMDSNLLQEIACYSQVYSDSLVFLALQMIHRHPLSLTGTNRKGETPSFLAEHSQFNACLEIKNVLRLTPKYISSTPFPTLLRQHLPKQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.