Basic Information | |
---|---|
Taxon OID | 3300010876 Open in IMG/M |
Scaffold ID | Ga0126361_11183581 Open in IMG/M |
Source Dataset Name | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 864 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alaska, USA | |||||||
Coordinates | Lat. (o) | 63.883 | Long. (o) | -145.733 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007705 | Metagenome / Metatranscriptome | 346 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126361_111835812 | F007705 | N/A | MPRNDAAAPGHVCPGIRIHAIDIVQPPGIGISPIADMDPHQTIVTAALVAKSSAETPKKARW |
⦗Top⦘ |