Basic Information | |
---|---|
Taxon OID | 3300010368 Open in IMG/M |
Scaffold ID | Ga0129324_10093530 Open in IMG/M |
Source Dataset Name | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1304 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Chesapeake Bay | |||||||
Coordinates | Lat. (o) | 38.0754 | Long. (o) | -76.1533 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059469 | Metagenome / Metatranscriptome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129324_100935301 | F059469 | N/A | IRDQLKIEKTRVNINDLIAANPDQQQVTSLANAIFRHVDNVAGFVNAVMKKNEALAKVEHTKLAFTNYQNMTRQGEDTFVGIIFMSGAKKWSNVVSNVDELVQNLAVGTIYVASPDQADLFPQTTYKF* |
⦗Top⦘ |