Basic Information | |
---|---|
Taxon OID | 3300010341 Open in IMG/M |
Scaffold ID | Ga0074045_10000757 Open in IMG/M |
Source Dataset Name | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 31558 |
Total Scaffold Genes | 28 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Calvert Island, British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017344 | Metagenome / Metatranscriptome | 241 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074045_1000075722 | F017344 | N/A | MTARRKVNLPEEVCAAAEQRFGARFHSLESLLEFVLREIVRDDAEALDRAEHEIIEKRLRDLGYK* |
⦗Top⦘ |