NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134082_10026574

Scaffold Ga0134082_10026574


Overview

Basic Information
Taxon OID3300010303 Open in IMG/M
Scaffold IDGa0134082_10026574 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2159
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: Angelo Coastal Reserve, California
CoordinatesLat. (o)39.7181Long. (o)-123.6527Alt. (m)Depth (m).4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005776Metagenome / Metatranscriptome390Y
F026521Metagenome / Metatranscriptome197N

Sequences

Protein IDFamilyRBSSequence
Ga0134082_100265741F005776N/AMRGSVLGLPLWLILAVCVVPPIAYSLSRAAGVPVELILPTAVAMEVVFLTQTVQQALRRAEVRRHFGFALWELHQELSQHLESLDRRMALVRQGVNSEPSLDALRTWASSVDTFPVDAWERFLAIGGLHRLLDSAPDQVASNLYRYYHGVGTFNDEAALRERQLQKLFNVTGPATAGIFKSVKSSDKRLESWLSEVPSLLAVLMRDIQHVIGDLGHMRGVIISGDDEERLAAINHRETEAYVRWRQSHGDVATPSIEPRRDWSIHDDPVR*
Ga0134082_100265742F026521GGAMGDRGVGEGPIDEAFDARMKRAVAVLQALLDYYRVKKVPPSASMERIEIEDAALAVAVGDFCLTDVALRLDALRYDLDPAGEPLTDEDGFPVE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.